PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025229-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 310aa    MW: 34110.4 Da    PI: 8.6687
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025229-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.39e-2960113357
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                    ++rYkeC++Nh as+Ggh++DGCgEfm++ geeg++++++CaACgCHR+FHR+e 
  NNU_025229-RA  60 AIRYKECQRNHSASIGGHTYDGCGEFMAA-GEEGSKESMRCAACGCHRSFHRKEF 113
                    689*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.1E-2761112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-2662112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-1862115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.48763112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.3E-29215288IPR009057Homeodomain-like
SuperFamilySSF466893.59E-19219288IPR009057Homeodomain-like
TIGRFAMsTIGR015652.8E-27228284IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDLSMVSYGH MESGKPEREN GGGDEGGMRP VEANRRFVGE PVMEQVSSSN GRMMGSVGRA  60
IRYKECQRNH SASIGGHTYD GCGEFMAAGE EGSKESMRCA ACGCHRSFHR KEFPGGCTAE  120
FQQRYLHHIQ SPPPPPPMVL YNHVGPAQNP GWERPKMGGG GGGGGGFPPI PAFPVPVHQR  180
VPVVGGMGAV DMRNLQYQQY QQQQSDQDRR SETPEEGEVQ MGSSVKNKRF RTKFTQEQKD  240
KMLEFAEKLG WRIQKHDDVA LNQFCSEVGV KRHVLKVWMH NNKNAQRKRE NSATPAAGVA  300
AAAATELIGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-292272851775ZF-HD homeobox family protein
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246039.10.0PREDICTED: zinc-finger homeodomain protein 1-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.23e-45homeobox protein 31